General Information

  • ID:  hor002246
  • Uniprot ID:  O02036
  • Protein name:  Kin-3
  • Gene name:  NA
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Kinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NTGRVHRQPKVVIRNPFHAWG
  • Length:  21(197-217)
  • Propeptide:  MAMLLQVALPLLAAVSWGWELNENDDSLAKIIEGCEWTSRQNVISEILLDRYRKYAMYNFFLLDDVCAVHEWNKNLKEPEFSENNEAEDKSPTSAQNTQEHIPGNNFPPPAASNPPVNSSCAKSAKDFFICLSNQLGDPTLNAMLLDNLEVACDPRFSPVSAIQKRNSKYVSKQKFYSWGGKRNNPNVFYPWGGKRNTGRVHRQPKVVIRNPFHAWGGKRNQKDDNVF
  • Signal peptide:  MAMLLQVALPLLAAVSWG
  • Modification:  T21 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates both fluid secretion by the Malpighian tubules and hindgut contractions. Depolarize the transepithelial voltage of the Malpighian tubules in concentrations of less than 10(-9) M and increase the frequency of hindgut contractions at concentratio
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O02036-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002246_AF2.pdbhor002246_ESM.pdb

Physical Information

Mass: 282675 Formula: C111H173N39O26
Absent amino acids: CDELMSY Common amino acids: RV
pI: 12.81 Basic residues: 6
Polar residues: 5 Hydrophobic residues: 7
Hydrophobicity: -86.67 Boman Index: -5498
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 64.76
Instability Index: 2447.62 Extinction Coefficient cystines: 5500
Absorbance 280nm: 275

Literature

  • PubMed ID:  20163154
  • Title:  Neuropeptidomics of the Mosquito Aedes Aegypti